General Information

  • ID:  hor005362
  • Uniprot ID:  Q3SAF0
  • Protein name:  Natriuretic peptide PpNP-b
  • Gene name:  NA
  • Organism:  Pseudechis porphyriacus (Red-bellied black snake)
  • Family:  natriuretic peptide family
  • Source:  animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Pseudechis (genus), Acanthophiinae (subfamily), Elapidae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera, Episquamata, Unidentata, Bifurcata, Squamata (order), Lepidosauria (class), Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SGSKTANIGDGCFGVRLDHIGTTSGMGCGRPRPKP
  • Length:  35
  • Propeptide:  SGSKTANIGDGCFGVRLDHIGTTSGMGCGRPRPKPTPGGS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Snake venom natriuretic peptide that exhibits hypotensive and vasodepressor activity. Acts by activating natriuretic receptors (NPR1 and/or NPR2 and/or NPR3) (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  12-28
  • Structure ID:  AF-Q3SAF0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005362_AF2.pdbhor005362_ESM.pdb

Physical Information

Mass: 413763 Formula: C146H241N49O47S3
Absent amino acids: EQWY Common amino acids: G
pI: 9.76 Basic residues: 6
Polar residues: 17 Hydrophobic residues: 6
Hydrophobicity: -54.29 Boman Index: -6649
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 44.57
Instability Index: 3909.43 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.68

Literature

  • PubMed ID:  16908092
  • Title:  Cloning and characterisation of natriuretic peptides from the venom glands of Australian elapids.